| CatalogCode: | | H00009567-A01 |
| ProductName: | | GTPBP1 Antibody |
| Product Description: | | Mouse Polyclonal anti-GTPBP1 |
| Clonality: | | Polyclonal |
| Immunogen: | | GTPBP1 (NP_004277, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. |
| Epitope: | | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV* ... |
| Specificity: | | GTPBP1 - GTP binding protein 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | | This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-GP-1 antibody, anti-GP1 antibody, anti-HSPC018 antibody, anti-MGC20069 antibody |
| ProteinTarget: | | GTPBP1 - GTP binding protein 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 9567 |
| Gene_Symbol: | | GTPBP1 |
| Omim_ID: | | 602245 H00009567-B01 |
| more information: | | company product webpage |