| request information: |
|
| Catalog Code: | H00009563-A01 |
| Product Name: | H6PD Antibody |
| Product Description: | Mouse Polyclonal anti-H6PD |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9563 |
| Gene Symbol: | H6PD |
| Omim ID: | 138090 604931 |
| Immunogen: | H6PD (NP_004276, 401 a.a. ~ 501 a.a) partial recombinant protein with GST tag. |
| Epitope: | HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENL
LASWNFWTPLLESLAHKAPRL* |
| Specificity: | H6PD - hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686A01246 antibody, anti-G6PDH antibody, anti-GDH antibody, anti-MGC87643 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |