| request information: |
|
| Catalog Code: | H00009542-A01 |
| Product Name: | NRG2 Antibody |
| Product Description: | Mouse Polyclonal anti-NRG2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9542 |
| Gene Symbol: | NRG2 |
| Omim ID: | 603818 |
| Immunogen: | NRG2 (NP_004874, 116 a.a. ~ 216 a.a) partial recombinant protein with GST tag. |
| Epitope: | SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRY
IFFLEPTEQPLVFKTAFAPLD* |
| Specificity: | NRG2 - neuregulin 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Neuregulin 2 (NRG2) is a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the Erbb family of receptors, NRG2 induces the growth and differentiation of epithelial, neuronal, glial, and other types of cells. The gene consists of 12 exons and the genomic structure is similar to that of neuregulin 1 (NRG1), another member of the neuregulin family of ligands. NRG1 and NRG2 mediate distinct biological processes by acting at different sites in tissues and eliciting different biological responses in cells. The gene is located close to the region for demyelinating Charcot-Marie-Tooth disease locus, but is not responsible for this disease. Alternative transcripts encoding distinct isoforms have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Don-1 antibody, anti-HRG2 antibody, anti-NTAK antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |