ExactAntigen

TP53I3 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009540-B02
Product Name:TP53I3 Antibody
Product Description:Mouse Polyclonal anti-TP53I3 - tumor protein p53 inducible protein 3, MaxPab Antibody
Clonality:Polyclonal
ListPrice:295
Gene ID:9540
Gene Symbol:TP53I3
Immunogen:TP53I3 (NP_004872, 1 a.a. ~ 332 a.a) full-length human protein.
Epitope:MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGH
WKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAI
QLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVL
YGLMGGGDINGPLFSKLL
Cross Reactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot.
Background:The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. At least two transcript variants encoding the same protein have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:Western Blot, ELISA
Species Summary:Hu
Alternate Names:anti-PIG3 antibody
Package Size:0.05 ml
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human PIG3 antibodies


2008©ExactAntigen home | browse | about