| request information: | |
| Catalog Code: | H00009533-M01 |
| Product Name: | POLR1C Antibody |
| Product Description: | Mouse Monoclonal anti-POLR1C (3A5-H2) |
| Clone: | 3A5-H2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9533 |
| Gene Symbol: | POLR1C |
| Immunogen: | POLR1C (AAH08863, 1 a.a. ~ 347 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQ DRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEV PTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRN QGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKV YTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPV |
| Specificity: | POLR1C - polymerase (RNA) I polypeptide C, 30kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Nuclear |
| Background: | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AC40 antibody, anti-DNA directed RNA polymerase I subunit C antibody, anti-DNA directed RNA polymerases I and III 40 kDa polypeptide antibody, anti-DNA directed RNA polymerases I and III subunit RPAC1 antibody, anti-POLR1E antibody, anti-RNA polymerases I and III subunit AC1 antibody, anti-RPA39 antibody, anti-RPA40 antibody, anti-RPC40 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |