| request information: |
|
| Catalog Code: | H00009517-A01 |
| Product Name: | SPTLC2 Antibody |
| Product Description: | Mouse Polyclonal anti-SPTLC2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9517 |
| Gene Symbol: | SPTLC2 |
| Omim ID: | 605713 |
| Immunogen: | SPTLC2 (NP_004854, 453 a.a. ~ 562 a.a) partial recombinant protein with GST tag. |
| Epitope: | LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEV
GDLLQLKYSRHRLVPLLDRPFDETTYEETE* |
| Specificity: | SPTLC2 - serine palmitoyltransferase, long chain base subunit 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I. Alternatively spliced variants encoding different isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KIAA0526 antibody, anti-LCB2 antibody, anti-SPT2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |