| request information: |
|
| Catalog Code: | H00009510-M01 |
| Product Name: | ADAMTS1 Antibody |
| Product Description: | Mouse Monoclonal anti-ADAMTS1 (2A9) |
| Clone: | 2A9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9510 |
| Gene Symbol: | ADAMTS1 |
| Omim ID: | 605174 |
| Immunogen: | ADAMTS1 (AAH36515, 858 a.a. ~ 968 a.a) partial recombinant protein with GST tag. |
| Epitope: | WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCL
SHDGGVLSHESCDPLKKPKHFIDFCTMAECS* |
| Specificity: | ADAMTS1 - a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-C3-C5 antibody, anti-KIAA1346 antibody, anti-METH1 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |