| request information: |
|
| Catalog Code: | H00009509-M03 |
| Product Name: | ADAMTS2 Antibody |
| Product Description: | Mouse Monoclonal anti-ADAMTS2 (7G3) |
| Clone: | 7G3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9509 |
| Gene Symbol: | ADAMTS2 |
| Omim ID: | 225410, 604539, |
| Immunogen: | ADAMTS2 (NP_055059, 1112 a.a. ~ 1211 a.a) partial recombinant protein with GST tag. |
| Epitope: | KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKT
RNQRIQELIDEMRKKEMLGK* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ADAM-TS2 antibody, anti-ADAMTS-3 antibody, anti-NPI antibody, anti-PCINP antibody, anti-PCPNI antibody, anti-hPCPNI antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|