| CatalogCode: | H00009509-A01 |
| ProductName: | ADAM metallopeptidase with thrombospondin type 1 motif, 2 Antibody |
| Product Description: | Mouse Polyclonal anti-ADAM metallopeptidase with thrombospondin type 1 motif, 2 |
| Clonality: | Polyclonal |
| Immunogen: | ADAMTS2 (NP_055059, 1112 a.a. ~ 1211 a.a) partial recombinant protein with GST tag. |
| Epitope: | KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK* ... |
| Specificity: | ADAM metallopeptidase with thrombospondin type 1 motif, 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ADAM-TS2 antibody, anti-ADAMTS-3 antibody, anti-NPI antibody, anti-PCINP antibody, anti-PCPNI antibody, anti-hPCPNI antibody |
| ProteinTarget: | ADAM metallopeptidase with thrombospondin type 1 motif, 2 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 9509 |
| Gene_Symbol: | ADAMTS2 |
| Omim_ID: | 225410, 604539, |
order or
more information: | company product webpage |
| request information: |
|