| request information: |
|
| Catalog Code: | H00009507-M01 |
| Product Name: | ADAMTS4 Antibody |
| Product Description: | Mouse Monoclonal anti-ADAMTS4 (2A6) |
| Clone: | 2A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9507 |
| Gene Symbol: | ADAMTS4 |
| Omim ID: | 603876, |
| Immunogen: | ADAMTS4 (AAH63293, 693 a.a. ~ 803 a.a) partial recombinant protein with GST tag. |
| Epitope: | RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETL
SGHGPLAQPLTLQVLVAGNPQDTRLRYSFFV* |
| Specificity: | ADAMTS4 - a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ADAMTS-2 antibody, anti-ADAMTS-4 antibody, anti-ADMP-1 antibody, anti-KIAA0688 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |