| CatalogCode: | H00009487-M01 |
| ProductName: | phosphatidylinositol glycan, class L Antibody |
| Product Description: | Mouse Monoclonal anti-phosphatidylinositol glycan, class L (2B6) |
| Clone: | 2B6 |
| Clonality: | Monoclonal |
| Immunogen: | PIGL (NP_004269, 153 a.a. ~ 253 a.a) partial recombinant protein with GST tag. |
| Epitope: | GHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL* ... |
| Specificity: | phosphatidylinositol glycan, class L |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ProteinTarget: | phosphatidylinositol glycan, class L |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 9487 |
| Gene_Symbol: | PIGL |
| Omim_ID: | 605947, |
order or
more information: | company product webpage |
| request information: |
|