| CatalogCode: | H00009475-M01 |
| ProductName: | ROCK2 Antibody |
| Product Description: | Mouse Monoclonal anti-ROCK2 (2A4) |
| Clone: | 2A4 |
| Clonality: | Monoclonal |
| Immunogen: | ROCK2 (NP_004841, 1279 a.a. ~ 1389 a.a) partial recombinant protein with GST tag. |
| Epitope: | KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS* ... |
| Specificity: | ROCK2 - Rho-associated, coiled-coil containing protein kinase 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-KIAA0619 antibody |
| ProteinTarget: | ROCK2 - Rho-associated, coiled-coil containing protein kinase 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 9475 |
| Gene_Symbol: | ROCK2 |
| Omim_ID: | 604002 H00009991-A01 |
order or
more information: | company product webpage |
| request information: |
|