| request information: |
|
| Catalog Code: | H00009473-M01 |
| Product Name: | C1orf38 Antibody |
| Product Description: | Mouse Monoclonal anti-C1orf38 (1C3) |
| Clone: | 1C3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9473 |
| Gene Symbol: | C1orf38 |
| Immunogen: | C1orf38 (AAH31655, 1 a.a. ~ 112 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLV LTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQG EDLARVHQGWLQYVQQDSCPQEGPQAR* |
| Specificity: | C1orf38 - chromosome 1 open reading frame 38 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Involved in cell adhesion. There are 4 isoforms produced by alternative splicing. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Ascites |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ICB1 antibody, anti-Induced by contact to basement membrane 1 protein antibody, anti-Protein ICB 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |