| request information: |
|
| Catalog Code: | H00009469-M01 |
| Product Name: | CHST3 Antibody |
| Product Description: | Mouse Monoclonal anti-CHST3 (1C4) |
| Clone: | 1C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9469 |
| Gene Symbol: | CHST3 |
| Omim ID: | 603799, 608637, |
| Immunogen: | CHST3 (NP_004264, 312 a.a. ~ 412 a.a) partial recombinant protein with GST tag. |
| Epitope: | VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAG
IPLTPQVEDWIQKNTQAAHDG* |
| Specificity: | CHST3 - carbohydrate (chondroitin 6) sulfotransferase 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-C6ST antibody, anti-C6ST1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |