| CatalogCode: | | H00009468-A01 |
| ProductName: | | PCYT1B Antibody |
| Product Description: | | Mouse Polyclonal anti-PCYT1B |
| Clonality: | | Polyclonal |
| Immunogen: | | PCYT1B (NP_004836, 236 a.a. ~ 315 a.a) partial recombinant protein with GST tag. |
| Epitope: | | NEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQAL* ... |
| Specificity: | | PCYT1B - phosphate cytidylyltransferase 1, choline, beta isoform |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CCT-beta antibody, anti-CTB antibody |
| ProteinTarget: | | PCYT1B - phosphate cytidylyltransferase 1, choline, beta isoform |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 9468 |
| Gene_Symbol: | | PCYT1B |
| Omim_ID: | | 604926 H00009468-B01 |
| more information: | | company product webpage |