| request information: |
|
| Catalog Code: | H00009464-M05 |
| Product Name: | HAND2 Antibody |
| Product Description: | Mouse Monoclonal anti-HAND2 (4D9) |
| Clone: | 4D9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9464 |
| Gene Symbol: | HAND2 |
| Omim ID: | 602407, |
| Immunogen: | HAND2 (NP_068808, 135 a.a. ~ 217 a.a) partial recombinant protein with GST tag. |
| Epitope: | LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWAL
ELK* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DHAND2 antibody, anti-Hed antibody, anti-MGC125303 antibody, anti-MGC125304 antibody, anti-Thing2 antibody, anti-dHand antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |