| request information: |
|
| Catalog Code: | H00009453-M08 |
| Product Name: | geranylgeranyl diphosphate synthase 1 Antibody |
| Product Description: | Mouse Monoclonal anti-geranylgeranyl diphosphate synthase 1 (1C3) |
| Clone: | 1C3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9453 |
| Gene Symbol: | GGPS1 |
| Omim ID: | 606982, |
| Immunogen: | GGPS1 (NP_004828, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. |
| Epitope: | NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARG
GNPELVALVKHLSKMFKEENE* |
| Specificity: | geranylgeranyl diphosphate synthase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GGPPS antibody, anti-GGPPS1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |