| request information: |
|
| Catalog Code: | H00009453-A01 |
| Product Name: | GGPS1 Antibody |
| Product Description: | Mouse Polyclonal anti-GGPS1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9453 |
| Gene Symbol: | GGPS1 |
| Omim ID: | 606982 |
| Immunogen: | GGPS1 (NP_004828, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. |
| Epitope: | NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARG
GNPELVALVKHLSKMFKEENE* |
| Specificity: | GGPS1 - geranylgeranyl diphosphate synthase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GGPPS antibody, anti-GGPPS1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |