ExactAntigen

GSTO1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009446-M03
Product Type:Primary Antibody
Product Name:GSTO1 Antibody
List Price:295
Clonality:Monoclonal
Gene ID:9446
Host:Mouse
Clone:1B6
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-GSTO1 - glutathione S-transferase omega 1 (1B6)
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis.
Alternate Names:anti-DKFZp686H13163 antibody, anti-GSTTLp28 antibody, anti-P28 antibody
Immunogen:GSTO1 (NP_004823, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human GSTO1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about