| Catalog Code: | H00009446-M03 |
| Product Type: | Primary Antibody |
| Product Name: | GSTO1 Antibody |
| List Price: | 295 |
| Clonality: | Monoclonal |
| Gene ID: | 9446 |
| Host: | Mouse |
| Clone: | 1B6 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-GSTO1 - glutathione S-transferase omega 1 (1B6) |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. |
| Alternate Names: | anti-DKFZp686H13163 antibody, anti-GSTTLp28 antibody, anti-P28 antibody |
| Immunogen: | GSTO1 (NP_004823, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, , Western Blot 1:500 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |