| request information: |
|
| Catalog Code: | H00009446-M01 |
| Product Name: | GSTO1 Antibody |
| Product Description: | Mouse Monoclonal anti-GSTO1 (3D9) |
| Clone: | 3D9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9446 |
| Gene Symbol: | GSTO1 |
| Omim ID: | 605482, |
| Immunogen: | GSTO1 (NP_004823, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Epitope: | SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKL
KLWMAAMKED* |
| Specificity: | GSTO1 - glutathione S-transferase omega 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686H13163 antibody, anti-GSTTLp28 antibody, anti-P28 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |