| CatalogCode: | | H00009446-A01 |
| ProductName: | | GSTO1 Antibody |
| Product Description: | | Mouse Polyclonal anti-GSTO1 |
| Clonality: | | Polyclonal |
| Immunogen: | | GSTO1 (NP_004823, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED* ... |
| Specificity: | | GSTO1 - glutathione S-transferase omega 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | | This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. |
| ProductRef: | | 1. Identification of Platinum-Resistance Associated Proteins through Proteomic Analysis of Human Ovarian Cancer Cells and Their Platinum-Resistant Sublines. Xue-dong Yan, Ning Mao et al. J. Proteome Res., ASAP Article 10.1021/pr060402r S1535-3893(06)004027. 2. Yan XD, Mao N et al.. Identification of platinum-resistance associated proteins through proteomic analysis of human ovarian cancer cells and their platinum-resistant sublines. J Proteome Res. 2007 Feb;6(2):772-80. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-DKFZp686H13163 antibody, anti-GSTTLp28 antibody, anti-P28 antibody |
| ProteinTarget: | | GSTO1 - glutathione S-transferase omega 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 9446 |
| Gene_Symbol: | | GSTO1 |
| Omim_ID: | | 605482 H00009446-M03 |
| more information: | | company product webpage |