| request information: |
|
| Catalog Code: | H00009429-A01 |
| Product Name: | ABCG2 Antibody |
| Product Description: | Mouse Polyclonal anti-ABCG2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9429 |
| Gene Symbol: | ABCG2 |
| Omim ID: | 603756 |
| Immunogen: | ABCG2 (NP_004818, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSSSNVEVFIPVSQGNTNGFPATVSNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAIL
GPTGGGKSSLLDVLAARKDPSGLSGDVLING* |
| Specificity: | ABCG2 - ATP-binding cassette, sub-family G (WHITE), member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ABC15 antibody, anti-ABCP antibody, anti-BCRP antibody, anti-BCRP1 antibody, anti-BMDP antibody, anti-EST157481 antibody, anti-MGC102821 antibody, anti-MRX antibody, anti-MXR antibody, anti-MXR1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |