| request information: |
|
| Catalog Code: | H00009426-A01 |
| Product Name: | chromodomain protein, Y-linked, 2A Antibody |
| Product Description: | Mouse Polyclonal anti-chromodomain protein, Y-linked, 2A |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9426 |
| Gene Symbol: | CDY2A |
| Omim ID: | 400018, |
| Immunogen: | CDY2A (NP_004816, 123 a.a. ~ 215 a.a) partial recombinant protein with GST tag. |
| Epitope: | ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNK
TQMHPLMSQMSGS* |
| Specificity: | chromodomain protein, Y-linked, 2A |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | This intronless gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CDY antibody, anti-CDY2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |