| request information: |
|
| Catalog Code: | H00009420-A01 |
| Product Name: | CYP7B1 Antibody |
| Product Description: | Mouse Polyclonal anti-CYP7B1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9420 |
| Gene Symbol: | CYP7B1 |
| Omim ID: | 231100, 603711, |
| Immunogen: | CYP7B1 (NP_004811, 203 a.a. ~ 287 a.a) partial recombinant protein with GST tag. |
| Epitope: | CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLE
IGAHH* |
| Specificity: | CYP7B1 - cytochrome P450, family 7, subfamily B, polypeptide 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CP7B antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |