ExactAntigen

IGSF2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009398-M01
Product Type:Primary Antibody
Product Name:IGSF2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9398
Host:Mouse
Clone:3G12
Isotype:IgG Mix Kappa
Product Description:Mouse Monoclonal anti-IGSF2 (3G12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = IGSF2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CD101 antibody, anti-V7 antibody
Immunogen:IGSF2 (NP_004249, 653 a.a. ~ 760 a.a) partial recombinant protein with GST tag.
Epitope:NRPPRASAISHPLRIAVTLPESKLKVNSRSQGQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQD* ...
Specificity:IGSF2 - immunoglobulin superfamily, member 2
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IGSF2
Omim ID:604516
see all human V7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about