| request information: |
|
| Catalog Code: | H00009380-M01 |
| Product Name: | GRHPR Antibody |
| Product Description: | Mouse Monoclonal anti-GRHPR (4E6-1F2) |
| Clone: | 4E6-1F2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9380 |
| Gene Symbol: | GRHPR |
| Omim ID: | 260000, 604296, |
| Immunogen: | GRHPR (AAH00605, 1 a.a. ~ 329 a.a) full length recombinant protein with GST tag. |
| Epitope: | MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVIS
TMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGI
IGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKET
AVFINISRGDVVNQDDLY |
| Specificity: | GRHPR - glyoxylate reductase/hydroxypyruvate reductase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
| Background: | This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GLXR antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |