| request information: |
|
| Catalog Code: | H00009370-A01 |
| Product Name: | ADIPOQ Antibody |
| Product Description: | Mouse Polyclonal anti-ADIPOQ |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9370 |
| Gene Symbol: | ADIPOQ |
| Omim ID: | 605441 |
| Immunogen: | ADIPOQ (NP_004788, 111 a.a. ~ 211 a.a) partial recombinant protein with GST tag. |
| Epitope: | YRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQY
QENNVDQASGSVLLHLEVGDQ* |
| Specificity: | ADIPOQ - adiponectin, C1Q and collagen domain containing |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACDC antibody, anti-ACRP30 antibody, anti-APM-1 antibody, anti-APM1 antibody, anti-GBP28 antibody, anti-adiponectin antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |