| request information: |
|
| Catalog Code: | H00009350-M04 |
| Product Name: | CER1 Antibody |
| Product Description: | Mouse Monoclonal anti-CER1 (3E11) |
| Clone: | 3E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9350 |
| Gene Symbol: | CER1 |
| Omim ID: | 603777, |
| Immunogen: | CER1 (NP_005445, 158 a.a. ~ 266 a.a) full length recombinant protein with GST tag. |
| Epitope: | HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLV
EECQCKVKTEHEDGHILHAGSQDSFIPGVS* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DAND4 antibody, anti-MGC119894 antibody, anti-MGC119895 antibody, anti-MGC96951 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |