ExactAntigen

TAOK2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009344-M03
Product Type:Primary Antibody
Product Name:TAOK2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9344
Host:Mouse
Clone:2E2
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-TAOK2 (2E2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-KIAA0881 antibody, anti-MAP3K17 antibody, anti-PSK antibody, anti-PSK1 antibody, anti-TAO1 antibody, anti-TAO2 antibody
Immunogen:TAOK2 (AAH51798, 831 a.a. ~ 931 a.a) partial recombinant protein with GST tag.
Epitope:ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug IgG purified Mouse ascites.
Package Size:100 ug
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:TAOK2
see all human TAOK2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about