| CatalogCode: | H00009328-B01 |
| ProductName: | GTF3C5 Antibody |
| Product Description: | Mouse Polyclonal anti-GTF3C5 - general transcription factor IIIC, polypeptide 5, 63kDa, MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | GTF3C5 (-, 1 a.a. ~ 519 a.a) full-length human protein. |
| Epitope: | MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELR ... |
| CrossReactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-TFIIIC63 antibody, anti-TFIIICepsilon antibody, anti-TFiiiC2-63 antibody |
| ProteinTarget: | general transcription factor IIIC, polypeptide 5, 63kDa |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 9328 |
| Gene_Symbol: | GTF3C5 |
order or more information: | company product webpage |
| request information: | |