| request information: |
|
| Catalog Code: | H00009314-M01 |
| Product Name: | KLF4 Antibody |
| Product Description: | Mouse Monoclonal anti-KLF4 (2F5) |
| Clone: | 2F5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9314 |
| Gene Symbol: | KLF4 |
| Omim ID: | 602253, |
| Immunogen: | KLF4 (AAH29923, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. |
| Epitope: | VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLG
RQLPSRTTPTLGLEEVLSSRD |
| Specificity: | KLF4 - Kruppel-like factor 4 (gut) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-KLF4 antibody, anti-Kruppel-like factor 4 (gut) antibody, anti-EZF antibody, anti-GKLF antibody, anti-endothelial Kruppel-like zinc finger protein antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Kruppel-like factor 4 regulates B cell number and activation-induced B cell proliferation. Klaewsongkram J, Weng NP. et al..J Immunol. 2007 Oct 1;179(7):4679-84. |
order or
more information: | company product webpage |