ExactAntigen

CD83 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009308-M01
Product Type:Primary Antibody
Product Name:CD83 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9308
Host:Mouse
Clone:3G10-1F4
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-CD83 (3G10-1F4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = CD83 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-BL11 antibody, anti-HB15 antibody
Immunogen:CD83 (AAH30830, 1 a.a. ~ 206 a.a) full length recombinant protein with GST tag.
Epitope:MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV* ...
Specificity:CD83 - CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:CD83
Omim ID:604534,
see all human CD83 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about