| CatalogCode: | H00009306-B01 |
| ProductType: | Primary Antibody |
| ProductName: | SOCS6 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 9306 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-SOCS6 - suppressor of cytokine signaling 6, MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein fam |
| ALTnames: | anti-CIS4 antibody, anti-HSPC060 antibody, anti-SOCS4 antibody, anti-SSI4 antibody, anti-STAI4 antibody, anti-STAT4 antibody, anti-STATI4 antibody |
| Immunogen: | SOCS6 (NP_004223, 1 a.a. ~ 535 a.a) full-length human protein. |
| Epitope: | MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPP ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |