| request information: |
|
| Catalog Code: | H00009306-A01 |
| Product Name: | SOCS6 Antibody |
| Product Description: | Mouse Polyclonal anti-SOCS6 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9306 |
| Gene Symbol: | SOCS6 |
| Omim ID: | 605118 |
| Immunogen: | SOCS6 (AAH20082, 1 a.a. ~ 536 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKR
RLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKAL
VHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGS
RSYCLDSSSPMEVSAVPP |
| Specificity: | SOCS6 - suppressor of cytokine signaling 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by GM-CSF and EPO in hematopoietic cells. A high expression level of this gene was found in factor-independent chronic myelogenous leukemia (CML) and erythroleukemia (HEL) cell lines. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CIS4 antibody, anti-HSPC060 antibody, anti-SOCS4 antibody, anti-SSI4 antibody, anti-STAI4 antibody, anti-STAT4 antibody, anti-STATI4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |