ExactAntigen

SOCS6 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009306-A01
Product Name:SOCS6 Antibody
Product Description:Mouse Polyclonal anti-SOCS6
Clonality:Polyclonal
ListPrice:225
Gene ID:9306
Gene Symbol:SOCS6
Omim ID:605118
Immunogen:SOCS6 (AAH20082, 1 a.a. ~ 536 a.a) full length recombinant protein with GST tag.
Epitope:MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKR
RLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKAL
VHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGS
RSYCLDSSSPMEVSAVPP
Specificity:SOCS6 - suppressor of cytokine signaling 6
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by GM-CSF and EPO in hematopoietic cells. A high expression level of this gene was found in factor-independent chronic myelogenous leukemia (CML) and erythroleukemia (HEL) cell lines.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CIS4 antibody, anti-HSPC060 antibody, anti-SOCS4 antibody, anti-SSI4 antibody, anti-STAI4 antibody, anti-STAT4 antibody, anti-STATI4 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human SOCS6 antibodies


2008©ExactAntigen home | browse | about