| request information: |
|
| Catalog Code: | H00009296-A01 |
| Product Name: | ATP6V1F Antibody |
| Product Description: | Mouse Polyclonal anti-ATP6V1F |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9296 |
| Gene Symbol: | ATP6V1F |
| Omim ID: | 607160, |
| Immunogen: | ATP6V1F (NP_004222, 10 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
| Epitope: | VIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAV
LEIPSKEHPYDAAKDSILRRARGMFTAEDLR* |
| Specificity: | ATP6V1F - ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ATP6S14 antibody, anti-MGC117321 antibody, anti-MGC126037 antibody, anti-MGC126038 antibody, anti-VATF antibody, anti-Vma7 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|