ExactAntigen

ITGB1BP1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009270-M04
Product Type:Primary Antibody
Product Name:ITGB1BP1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9270
Host:Mouse
Clone:3G4
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-ITGB1BP1 (3G4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = ITGB1BP1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-ICAP-1A antibody, anti-ICAP-1B antibody, anti-ICAP1 antibody, anti-ICAP1A antibody, anti-ICAP1B antibody
Immunogen:ITGB1BP1 (AAH12264, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Epitope:LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP* ...
Specificity:ITGB1BP1 - integrin beta 1 binding protein 1
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ITGB1BP1
Omim ID:607153,
see all human ITGB1BP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about