ExactAntigen

Mouse Polyclonal anti-ITGB1BP1 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00009270-A01
ProductName: ITGB1BP1 Antibody
Product Description: Mouse Polyclonal anti-ITGB1BP1
Clonality: Polyclonal
Immunogen: ITGB1BP1 (AAH12264, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Epitope: LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP* ...
Specificity: ITGB1BP1 - integrin beta 1 binding protein 1
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-ICAP-1A antibody, anti-ICAP-1B antibody, anti-ICAP1 antibody, anti-ICAP1A antibody, anti-ICAP1B antibody
ProteinTarget: ITGB1BP1 - integrin beta 1 binding protein 1
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 9270
Gene_Symbol: ITGB1BP1
Omim_ID: 607153 H00009270-M04
more information: company product webpage
Also see:
see all human ITGB1BP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about