| CatalogCode: | | H00009270-A01 |
| ProductName: | | ITGB1BP1 Antibody |
| Product Description: | | Mouse Polyclonal anti-ITGB1BP1 |
| Clonality: | | Polyclonal |
| Immunogen: | | ITGB1BP1 (AAH12264, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. |
| Epitope: | | LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP* ... |
| Specificity: | | ITGB1BP1 - integrin beta 1 binding protein 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-ICAP-1A antibody, anti-ICAP-1B antibody, anti-ICAP1 antibody, anti-ICAP1A antibody, anti-ICAP1B antibody |
| ProteinTarget: | | ITGB1BP1 - integrin beta 1 binding protein 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 9270 |
| Gene_Symbol: | | ITGB1BP1 |
| Omim_ID: | | 607153 H00009270-M04 |
| more information: | | company product webpage |