| request information: |
|
| Catalog Code: | H00009265-M01 |
| Product Name: | PSCD3 Antibody |
| Product Description: | Mouse Monoclonal anti-PSCD3 (6D3-1A9) |
| Clone: | 6D3-1A9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9265 |
| Gene Symbol: | PSCD3 |
| Omim ID: | 605081 |
| Immunogen: | PSCD3 (AAH08191, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. |
| Epitope: | MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKAS
ISRDPFYDMLATRKRRIANKK* |
| Specificity: | PSCD3 - pleckstrin homology, Sec7 and coiled-coil domains 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ARNO3 antibody, anti-GRP1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |