| request information: |
|
| Catalog Code: | H00009261-M01 |
| Product Name: | MAPKAPK2 Antibody |
| Product Description: | Mouse Monoclonal anti-MAPKAPK2 (2B3) |
| Clone: | 2B3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9261 |
| Gene Symbol: | MAPKAPK2 |
| Omim ID: | 602006, |
| Immunogen: | MAPKAPK2 (NP_116584, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. |
| Epitope: | IRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASN
PLLLKRRKKARALEAAALAH* |
| Specificity: | MAPKAPK2 - mitogen-activated protein kinase-activated protein kinase 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |