| request information: |
|
| Catalog Code: | H00009255-A01 |
| Product Name: | SCYE1 Antibody |
| Product Description: | Mouse Polyclonal anti-SCYE1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9255 |
| Gene Symbol: | SCYE1 |
| Omim ID: | 603605 |
| Immunogen: | SCYE1 (AAH14051, 1 a.a. ~ 313 a.a) full length recombinant protein with GST tag. |
| Epitope: | MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIP
FPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPIDVSRLDLR
IGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIE
ILAPPNGSVPGDRITFDA |
| Specificity: | SCYE1 - small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EMAP II antibody, anti-EMAP-2 antibody, anti-EMAP-II antibody, anti-EMAP2 antibody, anti-EMAPII antibody, anti-p43 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |