| request information: |
|
| Catalog Code: | H00009254-A01 |
| Product Name: | calcium channel, voltage-dependent, alpha 2/delta subunit 2 Antibody |
| Product Description: | Mouse Polyclonal anti-calcium channel, voltage-dependent, alpha 2/delta subunit 2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9254 |
| Gene Symbol: | CACNA2D2 |
| Omim ID: | 607082, |
| Immunogen: | CACNA2D2 (NP_006021, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. |
| Epitope: | PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAEN
FQKAHRWQDNIKEEDIVYY* |
| Specificity: | calcium channel, voltage-dependent, alpha 2/delta subunit 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CACNA2D antibody, anti-KIAA0558 antibody, anti-LUAC11.1 antibody, anti-gene 26 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |