| request information: |
|
| Catalog Code: | H00009244-M02 |
| Product Name: | CRLF1 Antibody |
| Product Description: | Mouse Monoclonal anti-CRLF1 - cytokine receptor-like factor 1 (5C2) |
| Clone: | 5C2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9244 |
| Gene Symbol: | CRLF1 |
| Immunogen: | CRLF1 (NP_004741, 135 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEA
TNRLGSARSDVLTLDIL* |
| Cross Reactivity: | Human. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CISS antibody, anti-CLF antibody, anti-CLF-1 antibody, anti-NR6 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |