| CatalogCode: | | H00009235-B01 |
| ProductName: | | IL32 Antibody |
| Product Description: | | Mouse Polyclonal anti-IL32 - interleukin 32, MaxPab Antibody |
| Clonality: | | Polyclonal |
| Immunogen: | | IL32 (NP_001012649, 1 a.a. ~ 188 a.a) full-length human protein. |
| Epitope: | | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK ... |
| CrossReactivity: | | Human. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-IL-32alpha antibody, anti-IL-32beta antibody, anti-IL-32delta antibody, anti-IL-32gamma antibody, anti-NK4 antibody, anti-TAIF antibody, anti-TAIFa antibody, anti-TAIFb antibody, anti-TAIFc antibody, anti-TAIFd antibody |
| ProteinTarget: | | interleukin 32 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 9235 |
| Gene_Symbol: | | IL32 |
| more information: | | company product webpage |