ExactAntigen

Mouse Polyclonal anti-IL32 - interleukin 32, MaxPab Antibody | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00009235-B01
ProductName: IL32 Antibody
Product Description: Mouse Polyclonal anti-IL32 - interleukin 32, MaxPab Antibody
Clonality: Polyclonal
Immunogen: IL32 (NP_001012649, 1 a.a. ~ 188 a.a) full-length human protein.
Epitope: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK ...
CrossReactivity: Human.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background: This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-IL-32alpha antibody, anti-IL-32beta antibody, anti-IL-32delta antibody, anti-IL-32gamma antibody, anti-NK4 antibody, anti-TAIF antibody, anti-TAIFa antibody, anti-TAIFb antibody, anti-TAIFc antibody, anti-TAIFd antibody
ProteinTarget: interleukin 32
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 9235
Gene_Symbol: IL32
more information: company product webpage
Also see:
see all human IL32 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about