ExactAntigen

PTTG1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009232-A01
Product Name:PTTG1 Antibody
Product Description:Mouse Polyclonal anti-PTTG1
Clonality:Polyclonal
ListPrice:225
Gene ID:9232
Gene Symbol:PTTG1
Omim ID:604147
Immunogen:PTTG1 (NP_004210, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKG
PLKQKQPSFSAKKMTEKTVKA*
Specificity:PTTG1 - pituitary tumor-transforming 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:The encoded protein is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The gene product has transforming activity in vitro and tumorigenic activity in vivo, and the gene is highly expressed in various tumors. The gene product contains 2 PXXP motifs, which are required for its transforming and tumorigenic activities, as well as for its stimulation of basic fibroblast growth factor expression. It also contains a destruction box (D box) that is required for its degradation by the APC. The acidic C-terminal region of the encoded protein can act as a transactivation domain. The gene product is mainly a cytosolic protein, although it partially localizes in the nucleus.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-EAP1 antibody, anti-HPTTG antibody, anti-PTTG antibody, anti-SECURIN antibody, anti-TUTR1 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human PTTG1 antibodies


2008©ExactAntigen home | browse | about