ExactAntigen

MAGI1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009223-M03
Product Type:Primary Antibody
Product Name:MAGI1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9223
Host:Mouse
Clone:7B4
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-MAGI1 (7B4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = MAGI1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-AIP3 antibody, anti-BAIAP1 antibody, anti-BAP1 antibody, anti-MAGI-1 antibody, anti-TNRC19 antibody, anti-WWP3 antibody
Immunogen:MAGI1 (NP_004733, 761 a.a. ~ 860 a.a) partial recombinant protein with GST tag.
Epitope:SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN* ...
Specificity:MAGI1 - membrane associated guanylate kinase, WW and PDZ domain containing 1
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:MAGI1
Omim ID:602625,
see all human MAGI 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about