ExactAntigen

MAGI1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009223-A01
Product Name:MAGI1 Antibody
Product Description:Mouse Polyclonal anti-MAGI1
Clonality:Polyclonal
ListPrice:225
Gene ID:9223
Gene Symbol:MAGI1
Omim ID:602625,
Immunogen:MAGI1 (NP_004733, 761 a.a. ~ 860 a.a) partial recombinant protein with GST tag.
Epitope:SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQE
QDIFLWRKETGFGFRILGGN*
Specificity:MAGI1 - membrane associated guanylate kinase, WW and PDZ domain containing 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-AIP3 antibody, anti-BAIAP1 antibody, anti-BAP1 antibody, anti-MAGI-1 antibody, anti-TNRC19 antibody, anti-WWP3 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human MAGI 1 antibodies


2008©ExactAntigen home | browse | about