| request information: | |
| Catalog Code: | H00009223-A01 |
| Product Name: | MAGI1 Antibody |
| Product Description: | Mouse Polyclonal anti-MAGI1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9223 |
| Gene Symbol: | MAGI1 |
| Omim ID: | 602625, |
| Immunogen: | MAGI1 (NP_004733, 761 a.a. ~ 860 a.a) partial recombinant protein with GST tag. |
| Epitope: | SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQE QDIFLWRKETGFGFRILGGN* |
| Specificity: | MAGI1 - membrane associated guanylate kinase, WW and PDZ domain containing 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AIP3 antibody, anti-BAIAP1 antibody, anti-BAP1 antibody, anti-MAGI-1 antibody, anti-TNRC19 antibody, anti-WWP3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |