| request information: |
|
| Catalog Code: | H00009212-M04 |
| Product Name: | AURKB Antibody |
| Product Description: | Mouse Monoclonal anti-AURKB (6G8) |
| Clone: | 6G8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9212 |
| Gene Symbol: | AURKB |
| Omim ID: | 604970, |
| Immunogen: | AURKB (AAH09751, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEI
GRPLGKGKFGN |
| Specificity: | AURKB - aurora kinase B |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Background: | Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases associate with microtubules during chromosome movement and segregation. Aurora kinase B localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers, and Aurora kinase A (MIM 603072) localizes to centrosomes (Lampson et al., 2004 [PubMed 14767480]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-AIK2 antibody, anti-AIM-1 antibody, anti-AIM1 antibody, anti-ARK2 antibody, anti-AurB antibody, anti-IPL1 antibody, anti-STK12 antibody, anti-STK5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |