| request information: |
|
| Catalog Code: | H00009208-B01 |
| Product Name: | LRRFIP1 Antibody |
| Product Description: | Mouse Polyclonal anti-LRRFIP1 - leucine rich repeat (in FLII) interacting protein 1, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 9208 |
| Gene Symbol: | LRRFIP1 |
| Immunogen: | LRRFIP1 (1 a.a. ~ 105 a.a) full-length human protein. |
| Epitope: | MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEE
LEVSNGHLVKRLEKMKANRSALLSQQ |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLAP-1 antibody, anti-FLIIAP1 antibody, anti-GCF-2 antibody, anti-GCF2 antibody, anti-HUFI-1 antibody, anti-MGC10947 antibody, anti-MGC119738 antibody, anti-MGC119739 antibody, anti-TRIP antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |