| request information: |
|
| Catalog Code: | H00009197-M07 |
| Product Name: | SLC33A1 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC33A1 (3A4) |
| Clone: | 3A4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9197 |
| Gene Symbol: | SLC33A1 |
| Omim ID: | 603690, |
| Immunogen: | SLC33A1 (NP_004724, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACATN antibody, anti-AT-1 antibody, anti-AT1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |