| request information: |
|
| Catalog Code: | H00009140-M01 |
| Product Name: | ATG12 Antibody |
| Product Description: | Mouse Monoclonal anti-ATG12 (2H8) |
| Clone: | 2H8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9140 |
| Gene Symbol: | ATG12 |
| Omim ID: | 609608, |
| Immunogen: | ATG12 (AAH11033, 1 a.a. ~ 75 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL* |
| Specificity: | ATG12 - ATG12 autophagy related 12 homolog (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-APG12 antibody, anti-APG12L antibody, anti-HAPG12 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |